SeqSimPresenter

Version 1.0.2: Sollte mit Hypercard 2.3 funktionieren.
Durch die zahlreichen Sequenzierprojekte steigt die Anzahl sequenzierter Gene und ihrer abgeleiteten Genprodukte schnell an. R?ckschl?sse auf eine Funktion ergeben sich h?ufig aus Sequenzverwandschaften, viele Sequenzen lassen sich in Familien und Superfamilien zusammenfassen. F?r eine Absch?tzung einer Verwandtschaft ist ein ?berblick ?ber die Verteilung hochkonservierter und weniger konservierter Regionen aussagekr?ftiger als ein einzelner Zahlenwert (X% Identit?t). Bei l?ngeren Sequenzen l??t sich diese Information aus den "alignten" Sequenzdaten, die einfach paarweise untereinandergeschrieben sind, kaum optisch erfassen.
SCORES     Init1: 322 Initn: 332 Opt: 532     35.8% identity in 293 aa overlap
330 340 350 360 370 380
cdc48.seq --DKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGI
:|::: :|:: :||: :||::::::| ||||||| : :|||| | ||:||:::: :
a34832 DSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPM
270 280 290 300 310 320
390 400 410 420 430 440
cdc48.seq PDATGRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLID
|::::| :::||:::|::: ||: |:|| |::: ||: ::| ||:| | :: ::
a34832 PNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGM--IALARGATE
330 340 350 360 370
Der SeqSimPresenter wandelt "alignte" Sequenzen in Graubalken um; der lokale Schw?rzungsgrad gibt die ƒhnlichkeit zur jeweils ersten Sequenz an. Die Verteilung der konservierten Bereiche ist mit einem Blick zu sehen, daher eignet sich die Darstellung besonders gut f?r die Pr?sentation von Sequenzvergleichen in Vortr?gen.

Tips zum Gebrauch

Das Programm erm?glicht eine Reihe von Optimierungen bei der Umwandlung der Sequenzen in die Schw?rzungsinformation. Neben der Beschr?nkung auf die Erfassung identischer bzw. unterschiedlicher Aminos?urereste k?nnen verschiedene "ƒhnlichkeitsskalen" (PAM, Blosum ..., auch selbstgemachte) beim Sequenzvergleich ber?cksichtigt werden. Die Grauwerte werden durch Summierung ?ber mehrere Aminos?urereste errechnte, die Breite und Verschiebung des Summierungsfensters ist w?hlbar. In der Balkengrafik lassen sich Bereiche markieren, n?tzlich, wenn z.B. die Lage einer funktionellen Domaine (z.B. ATP-Bindungsstelle) bekannt ist. Hintergrundsrauschen (selbst v?llig unverwandte Sequenzen haben einen Anteil identischer Reste) l??t sich durch Angabe eines Schwellenwerts unterdr?cken. Eine Grauskala (Grauwert vs. Identit?t), die auch diese Schwellenwerte ber?cksichtigt, kann mit ausgedruckt werden, ebenso eine Aminos?ureskala auf dem obersten Balken. Die entstehende Graphik ist eine Postscriptdatei im Adobe Illustrator-Format. Sie kann direkt aus dem Programm auf einen Postscript-f?higen Drucker geschickt, oder in Illustrator ge?ffnet und weiter bearbeitet werden.

Eione Beschreibung des SeqSimPresenter ist publiziert:
Kai-Uwe Fr?hlich: Sequence Similarity Presenter: a tool for the graphic display of similarities of long sequences for use in presentations. Comput. Appl. Biosci. 10, 179-183 (1994)

Her damit!


[To our home page][Zur?ck zum Archiv]

Last edited: March 6, 1997 by KaiFr