SeqSimPresenter

Version 1.0.2: Sollte mit Hypercard 2.3 funktionieren.
Durch die zahlreichen Sequenzierprojekte steigt die Anzahl sequenzierter Gene und ihrer abgeleiteten Genprodukte schnell an. Rückschlüsse auf eine Funktion ergeben sich häufig aus Sequenzverwandschaften, viele Sequenzen lassen sich in Familien und Superfamilien zusammenfassen. Für eine Abschätzung einer Verwandtschaft ist ein Überblick über die Verteilung hochkonservierter und weniger konservierter Regionen aussagekräftiger als ein einzelner Zahlenwert (X% Identität). Bei längeren Sequenzen läßt sich diese Information aus den "alignten" Sequenzdaten, die einfach paarweise untereinandergeschrieben sind, kaum optisch erfassen.
SCORES     Init1: 322 Initn: 332 Opt: 532     35.8% identity in 293 aa overlap
330 340 350 360 370 380
cdc48.seq --DKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGI
:|::: :|:: :||: :||::::::| ||||||| : :|||| | ||:||:::: :
a34832 DSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPM
270 280 290 300 310 320
390 400 410 420 430 440
cdc48.seq PDATGRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLID
|::::| :::||:::|::: ||: |:|| |::: ||: ::| ||:| | :: ::
a34832 PNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGM--IALARGATE
330 340 350 360 370
Der SeqSimPresenter wandelt "alignte" Sequenzen in Graubalken um; der lokale Schwärzungsgrad gibt die Ähnlichkeit zur jeweils ersten Sequenz an. Die Verteilung der konservierten Bereiche ist mit einem Blick zu sehen, daher eignet sich die Darstellung besonders gut für die Präsentation von Sequenzvergleichen in Vorträgen.

Tips zum Gebrauch

Das Programm ermöglicht eine Reihe von Optimierungen bei der Umwandlung der Sequenzen in die Schwärzungsinformation. Neben der Beschränkung auf die Erfassung identischer bzw. unterschiedlicher Aminosäurereste können verschiedene "Ähnlichkeitsskalen" (PAM, Blosum ..., auch selbstgemachte) beim Sequenzvergleich berücksichtigt werden. Die Grauwerte werden durch Summierung über mehrere Aminosäurereste errechnte, die Breite und Verschiebung des Summierungsfensters ist wählbar. In der Balkengrafik lassen sich Bereiche markieren, nützlich, wenn z.B. die Lage einer funktionellen Domaine (z.B. ATP-Bindungsstelle) bekannt ist. Hintergrundsrauschen (selbst völlig unverwandte Sequenzen haben einen Anteil identischer Reste) läßt sich durch Angabe eines Schwellenwerts unterdrücken. Eine Grauskala (Grauwert vs. Identität), die auch diese Schwellenwerte berücksichtigt, kann mit ausgedruckt werden, ebenso eine Aminosäureskala auf dem obersten Balken. Die entstehende Graphik ist eine Postscriptdatei im Adobe Illustrator-Format. Sie kann direkt aus dem Programm auf einen Postscript-fähigen Drucker geschickt, oder in Illustrator geöffnet und weiter bearbeitet werden.

Eione Beschreibung des SeqSimPresenter ist publiziert:
Kai-Uwe Fröhlich: Sequence Similarity Presenter: a tool for the graphic display of similarities of long sequences for use in presentations. Comput. Appl. Biosci. 10, 179-183 (1994)

Her damit!


[To our home page][Zurück zum Archiv]

Last edited: March 6, 1997 by KaiFr